PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 679aa    MW: 76429.1 Da    PI: 6.7624
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766016.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK48.12.3e-15492535346
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                     ++i+l++++   s++  +AA++Lgv+ ++LKriCR yGI RWP 
  XP_009766016.1 492 HNINLKKIEDRSSMTQDAAANDLGVGKSTLKRICRLYGITRWPP 535
                     79*****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.707478563IPR003035RWP-RK domain
PfamPF020424.7E-12493536IPR003035RWP-RK domain
SuperFamilySSF542771.77E-12594676No hitNo description
SMARTSM006661.7E-11596678IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.0E-13596677No hitNo description
PROSITE profilePS5174518.034596678IPR000270PB1 domain
PfamPF005644.4E-12600677IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MVIKERVKIA LQHVEKLSCN YLIQYWASIV IDGQTFLTTS DQPFGLTRLE YGLCSYRKKC  60
LSHAIPVELK NGTQCENDLG PPGRVFKHRL PELCTDVKNY SQQEFPLRDD AVAWSIQWCY  120
TVPVFDPSRD TFVGVLELVT SHQTKEWIFG NSVLPIFKML QVVDLKSPDS YCPLDLKVLD  180
DRQCALGGLY KAIEVVCQKH QFLFAQIWVS VADSWCTGKV ITVRQRHIAI NDNQNLNLFK  240
YASGLQYILE GYGVVGRAFS SKSSCFCRDV TRLSIMEYPL VTCAREAGLT GCFAICLSAP  300
GNDDNVFILE FFLPPNELLR RNLQDFLKLV LGTVKQQLQH VKVAVGHDFG EMLPVEVIKI  360
SSDDELDSFD ICQTTKELQN AEPLPNGGEL MLLDTPNQQS FSSETNQQLS LDIDEINAER  420
DSIAVSEEQC NSAGSSTSAK TSQNKERKLQ LDLSTRQAKQ GANAGNKRKK GKRIFTSESE  480
IQKERERIEQ DHNINLKKIE DRSSMTQDAA ANDLGVGKST LKRICRLYGI TRWPPKNKEK  540
KTKCSHSRKM KSILPAEEDV NARTKFQQSS DSPNKEDTIN GAKVGAHVTE ILDGTAVITK  600
VNYGDRMLKL KLTSSSKMKD LEEEVVKRVE SSIESFDFTY VDKEGDTILI KCDEDLTECF  660
LHSRSSESAT VKMSITPKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766016.10.0PREDICTED: protein NLP7-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13034410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-56Nin-like family protein